PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn219251
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 333aa    MW: 38079.9 Da    PI: 9.9104
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn219251genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26093.23.1e-2914110197
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                 aCa+Ck++r+kC+k+Cvlap+fp   +k+f+ vhklFG sn++k+++++    ++++++s ++eA  + +dP +G +g++++l q+ + l++  + l
  Achn219251  14 ACASCKHQRKKCPKKCVLAPHFPPGLEKEFEQVHKLFGISNMTKMIRKTAFPLQKEMVKSFIWEASLWRQDPDHGPLGFYNRLDQRNNFLEQRNNFL 110
                 7************************************************************************************999988876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.98513114IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-2714106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MSSDDERRSS LRPACASCKH QRKKCPKKCV LAPHFPPGLE KEFEQVHKLF GISNMTKMIR  60
KTAFPLQKEM VKSFIWEASL WRQDPDHGPL GFYNRLDQRN NFLEQRNNFL ERERELYLRN  120
QMVQLPMAQL PYSSNNGFWT VPYYNGQSLF QANPATLDTH GNISSSSSQR GVHGLDRLIQ  180
EQARQSNGRD GSIPHFYHPN FVQEQNYQPL FQGPEIDYLI RGGFAHTSNA EFLERGERAS  240
VGGHNGQFEA PHSSPLQRQE STIQNNNINP GLSNLSFPTS TIYRLSLRNL NRKNILLQTK  300
CKPQLCSSDM KQRRALLTNR SCVAQSSAFH SP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101771827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.18e-24LOB domain-containing protein 2